PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim04g064550.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 564aa    MW: 63074.8 Da    PI: 4.8719
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim04g064550.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS443.21.7e-1351955633374
                GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                         + L++cA a+++g+ e+a++++++l++++s +gdp+ R aay++eALaar+a s+ +lykal+++e++   sse+l+a+++++ev+P+++f
  Sopim04g064550.0.1 195 QMLFSCAAAIQDGHIEQASSMINELRQMVSIQGDPLGRTAAYMVEALAARMATSGRGLYKALKCKEAT---SSERLSAMQVLFEVCPYFRF 282
                         79*****************************************************************9...9******************* PP

                GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlv 182
                         ++++aN aIlea++ e+rvHiiDfd++qG Q+ +Llq+L s p++pp++R+Tgv++pes+      l+ +g rLa++A+ l+++fef++ v
  Sopim04g064550.0.1 283 GFMAANGAILEAFKDEKRVHIIDFDVNQGSQYYTLLQTLGSMPGKPPHVRLTGVDDPESVqrAIGGLNVIGLRLAQLAKDLKISFEFQA-V 372
                         **********************************************************99777789***********************.7 PP

                GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                         +++++ +++ +L+++pgEa+ Vn+++qlh+++desvs+ ++rd++L++vksl+Pk+v+vveq++++n+++Fl+rf+e  +yy a+f+sl+a
  Sopim04g064550.0.1 373 SSNTALVTPAMLNCRPGEAVLVNFAFQLHHMPDESVSTVNQRDQLLRMVKSLNPKLVTVVEQDMNTNTAPFLQRFAEVYNYYCAVFESLDA 463
                         ******************************************************************************************* PP

                GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkd 364
                         +l+r+s+er++vEr++l+r+i n+vaceg er+er e ++kWr+r+++aGF+p p+s +++++++ l+++++++ y+ eee g+l++gW+d
  Sopim04g064550.0.1 464 TLSRDSQERVNVERQCLARDIINIVACEGLERIERYEVAGKWRARMMMAGFTPSPISRNVYESIRNLIKQYSER-YKAEEEAGALYFGWED 553
                         ************************************************************************66.**************** PP

                GRAS 365 rpLvsvSaWr 374
                         ++L+++SaWr
  Sopim04g064550.0.1 554 KTLTVASAWR 563
                         *********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.946167544IPR005202Transcription factor GRAS
PfamPF035146.0E-133195563IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 564 aa     Download sequence    Send to blast
MSLVRSLRSI GNGKLYFQNG HNDNSSLATS MYTKNARGIM YATESSSTDS YDPKYLLESP  60
SPSEELLNTS PTDVLGNPFH QRHSSSFHPS RDYNQVSYDS ADCVNQSPDS SEYNDGRVTM  120
KLQELERVLF DDNEIEGDDV FARGETVDID DEWFNQIRTE LLQESPKEST SADSNTSSSS  180
SYKEISVSAP QTPKQMLFSC AAAIQDGHIE QASSMINELR QMVSIQGDPL GRTAAYMVEA  240
LAARMATSGR GLYKALKCKE ATSSERLSAM QVLFEVCPYF RFGFMAANGA ILEAFKDEKR  300
VHIIDFDVNQ GSQYYTLLQT LGSMPGKPPH VRLTGVDDPE SVQRAIGGLN VIGLRLAQLA  360
KDLKISFEFQ AVSSNTALVT PAMLNCRPGE AVLVNFAFQL HHMPDESVST VNQRDQLLRM  420
VKSLNPKLVT VVEQDMNTNT APFLQRFAEV YNYYCAVFES LDATLSRDSQ ERVNVERQCL  480
ARDIINIVAC EGLERIERYE VAGKWRARMM MAGFTPSPIS RNVYESIRNL IKQYSERYKA  540
EEEAGALYFG WEDKTLTVAS AWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-591955636375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0135910.0BT013591.1 Lycopersicon esculentum clone 132354R, mRNA sequence.
GenBankDQ3998280.0DQ399828.1 Lycopersicon esculentum GRAS6 (GRAS6) mRNA, complete cds.
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010319997.10.0PREDICTED: GRAS6 protein isoform X1
RefseqXP_010319995.10.0PREDICTED: GRAS6 protein isoform X1
RefseqNP_001293096.10.0GRAS6 protein
RefseqNP_001293095.10.0GRAS6 protein
RefseqNP_001293094.10.0GRAS6 protein
RefseqNP_001293093.10.0GRAS6 protein
RefseqNP_001293092.10.0GRAS6 protein
RefseqNP_001234315.20.0GRAS6 protein
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLK4BT460.0K4BT46_SOLLC; Uncharacterized protein
STRINGSolyc04g064550.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89672429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1